Anti-PTPN4, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-PTPN4, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA019351
• Supplier Catalog Number: HPA019351
• Alternative Catalog Number: ATA-HPA019351-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, ICC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: PTPMEG

Product Description

protein tyrosine phosphatase, non-receptor type 4 (megakaryocyte)

Additional Information

Anti-PTPN4

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 5775
• UniProt: P29074
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: EQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQVTCHSEEGNTAYIFRKMTLFNQEKNESRPLTQIQYIAWPDHGVPDDSSDFL
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cytosol.

Immunohistochemical staining of human kidney shows strong membranous positivity in cells in tubules.

Immunohistochemical staining of human duodenum shows moderate positivity in apical membrane in glandular cells.

Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp