Anti-CROT Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA019364
Artikelname: Anti-CROT Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA019364
Hersteller Artikelnummer: HPA019364
Alternativnummer: ATA-HPA019364-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: COT
carnitine O-octanoyltransferase
Anti-CROT
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 54677
UniProt: Q9UKG9
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VRWGDKSYNLISFSNGVFGCNCDHAPFDAMIMVNISYYVDEKIFQNEGRWKGSEKVRDIPLPEELIFIVDEKVLNDINQAKAQYLR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CROT
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human thyroid gland and skeletal muscle tissues using Anti-CROT antibody. Corresponding CROT RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human thyroid gland shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Western blot analysis using Anti-CROT antibody HPA019364 (A) shows similar pattern to independent antibody HPA019365 (B).
Western blot analysis in control (vector only transfected HEK293T lysate) and CROT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412059).
HPA019364
HPA019364
HPA019364