Anti-CROT

Catalog Number: ATA-HPA019364
Article Name: Anti-CROT
Biozol Catalog Number: ATA-HPA019364
Supplier Catalog Number: HPA019364
Alternative Catalog Number: ATA-HPA019364-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: COT
carnitine O-octanoyltransferase
Anti-CROT
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 54677
UniProt: Q9UKG9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VRWGDKSYNLISFSNGVFGCNCDHAPFDAMIMVNISYYVDEKIFQNEGRWKGSEKVRDIPLPEELIFIVDEKVLNDINQAKAQYLR
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CROT
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human thyroid gland and skeletal muscle tissues using Anti-CROT antibody. Corresponding CROT RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human thyroid gland shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Western blot analysis using Anti-CROT antibody HPA019364 (A) shows similar pattern to independent antibody HPA019365 (B).
Western blot analysis in control (vector only transfected HEK293T lysate) and CROT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412059).
HPA019364-100ul
HPA019364-100ul
HPA019364-100ul