Anti-LRBA

Artikelnummer: ATA-HPA019366
Artikelname: Anti-LRBA
Artikelnummer: ATA-HPA019366
Hersteller Artikelnummer: HPA019366
Alternativnummer: ATA-HPA019366-100,ATA-HPA019366-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: BGL, CDC4L, LAB300, LBA
LPS-responsive vesicle trafficking, beach and anchor containing
Anti-LRBA
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 987
UniProt: P50851
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SVLMVSKYRDILEPQNERHSQSCTETGSENENVSLSEITPAAFSTLTTASVEESESTSSARRRDSGIGEETATGLGSHVEVTPHTAPPGVSAGPDAISEVLSTLSLEVNKSPETKNDRGNDLDTKATPSVSV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: LRBA
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & the Golgi apparatus.
Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemical staining of human lymphoid tissues shows strong cytoplasmic positivity in a subset of germinal center cells.
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
HPA019366-100ul
HPA019366-100ul
HPA019366-100ul