Anti-LRBA

Catalog Number: ATA-HPA019366
Article Name: Anti-LRBA
Biozol Catalog Number: ATA-HPA019366
Supplier Catalog Number: HPA019366
Alternative Catalog Number: ATA-HPA019366-100,ATA-HPA019366-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: BGL, CDC4L, LAB300, LBA
LPS-responsive vesicle trafficking, beach and anchor containing
Anti-LRBA
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 987
UniProt: P50851
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SVLMVSKYRDILEPQNERHSQSCTETGSENENVSLSEITPAAFSTLTTASVEESESTSSARRRDSGIGEETATGLGSHVEVTPHTAPPGVSAGPDAISEVLSTLSLEVNKSPETKNDRGNDLDTKATPSVSV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: LRBA
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & the Golgi apparatus.
Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemical staining of human lymphoid tissues shows strong cytoplasmic positivity in a subset of germinal center cells.
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
HPA019366-100ul
HPA019366-100ul
HPA019366-100ul