Anti-LRBA Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-LRBA Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA019366
• Supplier Catalog Number: HPA019366
• Alternative Catalog Number: ATA-HPA019366-100,ATA-HPA019366-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: BGL, CDC4L, LAB300, LBA

Product Description

LPS-responsive vesicle trafficking, beach and anchor containing

Additional Information

Anti-LRBA

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 987
• UniProt: P50851
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: SVLMVSKYRDILEPQNERHSQSCTETGSENENVSLSEITPAAFSTLTTASVEESESTSSARRRDSGIGEETATGLGSHVEVTPHTAPPGVSAGPDAISEVLSTLSLEVNKSPETKNDRGNDLDTKATPSVSV
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: LRBA
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500

Images

Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & the Golgi apparatus.

Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Immunohistochemical staining of human lymphoid tissues shows strong cytoplasmic positivity in a subset of germinal center cells.

Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.

HPA019366

HPA019366

HPA019366