Anti-SAMD9L
Artikelnummer:
ATA-HPA019488
- Bilder (8)
| Artikelname: | Anti-SAMD9L |
| Artikelnummer: | ATA-HPA019488 |
| Hersteller Artikelnummer: | HPA019488 |
| Alternativnummer: | ATA-HPA019488-100,ATA-HPA019488-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C7orf6, FLJ39885, KIAA2005 |
| sterile alpha motif domain containing 9-like |
| Anti-SAMD9L |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 219285 |
| UniProt: | Q8IVG5 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EVDTIPKHSICNDKYFYIQMQICKDKIWKQNQNLSLFVREGASSRDILANSKQRDVDFKAFLQNLKSLVASRKEAEEEYGMKAMKKESEGLKLVKLL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SAMD9L |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human appendix, kidney, lymph node and testis using Anti-SAMD9L antibody HPA019488 (A) shows similar protein distribution across tissues to independent antibody HPA019461 (B). |
|
|
Immunohistochemical staining of human appendix using Anti-SAMD9L antibody HPA019488. |
|
|
Immunohistochemical staining of human testis using Anti-SAMD9L antibody HPA019488. |
|
|
Immunohistochemical staining of human kidney using Anti-SAMD9L antibody HPA019488. |
|
|
Immunohistochemical staining of human lymph node using Anti-SAMD9L antibody HPA019488. |
|
|
HPA019488-100ul |
|
|
HPA019488-100ul |
|
|
HPA019488-100ul |
Produktgarantie und fachkundiger Support
