Anti-SAMD9L
Catalog Number:
ATA-HPA019488
- Images (8)
| Article Name: | Anti-SAMD9L |
| Biozol Catalog Number: | ATA-HPA019488 |
| Supplier Catalog Number: | HPA019488 |
| Alternative Catalog Number: | ATA-HPA019488-100,ATA-HPA019488-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C7orf6, FLJ39885, KIAA2005 |
| sterile alpha motif domain containing 9-like |
| Anti-SAMD9L |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 219285 |
| UniProt: | Q8IVG5 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EVDTIPKHSICNDKYFYIQMQICKDKIWKQNQNLSLFVREGASSRDILANSKQRDVDFKAFLQNLKSLVASRKEAEEEYGMKAMKKESEGLKLVKLL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SAMD9L |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human appendix, kidney, lymph node and testis using Anti-SAMD9L antibody HPA019488 (A) shows similar protein distribution across tissues to independent antibody HPA019461 (B). |
|
|
Immunohistochemical staining of human appendix using Anti-SAMD9L antibody HPA019488. |
|
|
Immunohistochemical staining of human testis using Anti-SAMD9L antibody HPA019488. |
|
|
Immunohistochemical staining of human kidney using Anti-SAMD9L antibody HPA019488. |
|
|
Immunohistochemical staining of human lymph node using Anti-SAMD9L antibody HPA019488. |
|
|
HPA019488-100ul |
|
|
HPA019488-100ul |
|
|
HPA019488-100ul |
Product Guarantee and Expert Support
