Anti-ANXA13
Artikelnummer:
ATA-HPA019569
- Bilder (8)
| Artikelname: | Anti-ANXA13 |
| Artikelnummer: | ATA-HPA019569 |
| Hersteller Artikelnummer: | HPA019569 |
| Alternativnummer: | ATA-HPA019569-100,ATA-HPA019569-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ANX13 |
| annexin A13 |
| Anti-ANXA13 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 312 |
| UniProt: | P27216 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | AIIEILSGRTSDERQQIKQKYKATYGKELEEVLKSELSGNFEKTALALLDRPSEYAARQLQKAMKGLGTDESVLIEV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ANXA13 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human duodenum, fallopian tube, gallbladder and small intestine using Anti-ANXA13 antibody HPA019569 (A) shows similar protein distribution across tissues to independent antibody HPA018535 (B). |
|
|
Immunohistochemical staining of human fallopian tube using Anti-ANXA13 antibody HPA019569. |
|
|
Immunohistochemical staining of human small intestine using Anti-ANXA13 antibody HPA019569. |
|
|
Immunohistochemical staining of human duodenum using Anti-ANXA13 antibody HPA019569. |
|
|
Immunohistochemical staining of human gallbladder using Anti-ANXA13 antibody HPA019569. |
|
|
HPA019569-100ul |
|
|
HPA019569-100ul |
|
|
HPA019569-100ul |
Produktgarantie und fachkundiger Support
