Anti-ANXA13
Catalog Number:
ATA-HPA019569
- Images (8)
| Article Name: | Anti-ANXA13 |
| Biozol Catalog Number: | ATA-HPA019569 |
| Supplier Catalog Number: | HPA019569 |
| Alternative Catalog Number: | ATA-HPA019569-100,ATA-HPA019569-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ANX13 |
| annexin A13 |
| Anti-ANXA13 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 312 |
| UniProt: | P27216 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | AIIEILSGRTSDERQQIKQKYKATYGKELEEVLKSELSGNFEKTALALLDRPSEYAARQLQKAMKGLGTDESVLIEV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ANXA13 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human duodenum, fallopian tube, gallbladder and small intestine using Anti-ANXA13 antibody HPA019569 (A) shows similar protein distribution across tissues to independent antibody HPA018535 (B). |
|
|
Immunohistochemical staining of human fallopian tube using Anti-ANXA13 antibody HPA019569. |
|
|
Immunohistochemical staining of human small intestine using Anti-ANXA13 antibody HPA019569. |
|
|
Immunohistochemical staining of human duodenum using Anti-ANXA13 antibody HPA019569. |
|
|
Immunohistochemical staining of human gallbladder using Anti-ANXA13 antibody HPA019569. |
|
|
HPA019569-100ul |
|
|
HPA019569-100ul |
|
|
HPA019569-100ul |
Product Guarantee and Expert Support
