Anti-BCL7A Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA019762
Artikelname: Anti-BCL7A Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA019762
Hersteller Artikelnummer: HPA019762
Alternativnummer: ATA-HPA019762-100,ATA-HPA019762-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: BCL7
B-cell CLL/lymphoma 7A
Anti-BCL7A
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 605
UniProt: Q4VC05
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: QADGKEHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: BCL7A
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm & vesicles.
Immunohistochemical staining of human liver shows no nuclear positivity in hepatocytes as expected.
Immunohistochemical staining of human lymphoid tissues shows strong nuclear positivity in germinal center cells.
Immunohistochemical staining of human cerebellum shows strong nuclear positivity in purkinje cells.
Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in neurons.
Western blot analysis in control (vector only transfected HEK293T lysate) and BCL7A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY422541).
HPA019762
HPA019762