Anti-BCL7A

Catalog Number: ATA-HPA019762
Article Name: Anti-BCL7A
Biozol Catalog Number: ATA-HPA019762
Supplier Catalog Number: HPA019762
Alternative Catalog Number: ATA-HPA019762-100,ATA-HPA019762-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: BCL7
B-cell CLL/lymphoma 7A
Anti-BCL7A
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 605
UniProt: Q4VC05
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QADGKEHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: BCL7A
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm & vesicles.
Immunohistochemical staining of human liver shows no nuclear positivity in hepatocytes as expected.
Immunohistochemical staining of human lymphoid tissues shows strong nuclear positivity in germinal center cells.
Immunohistochemical staining of human cerebellum shows strong nuclear positivity in purkinje cells.
Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in neurons.
Western blot analysis in control (vector only transfected HEK293T lysate) and BCL7A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY422541).
HPA019762-100ul
HPA019762-100ul