Anti-BCL7A Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-BCL7A Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA019762
• Supplier Catalog Number: HPA019762
• Alternative Catalog Number: ATA-HPA019762-100,ATA-HPA019762-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: BCL7

Product Description

B-cell CLL/lymphoma 7A

Additional Information

Anti-BCL7A

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 605
• UniProt: Q4VC05
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: QADGKEHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSE
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: BCL7A
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm & vesicles.

Immunohistochemical staining of human liver shows no nuclear positivity in hepatocytes as expected.

Immunohistochemical staining of human lymphoid tissues shows strong nuclear positivity in germinal center cells.

Immunohistochemical staining of human cerebellum shows strong nuclear positivity in purkinje cells.

Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in neurons.

Western blot analysis in control (vector only transfected HEK293T lysate) and BCL7A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY422541).

HPA019762

HPA019762