Anti-NDUFV3

Artikelnummer: ATA-HPA019791
Artikelname: Anti-NDUFV3
Artikelnummer: ATA-HPA019791
Hersteller Artikelnummer: HPA019791
Alternativnummer: ATA-HPA019791-100,ATA-HPA019791-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CI-10k
NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa
Anti-NDUFV3
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 4731
UniProt: P56181
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PPLPRKETSGTQGIEGHLKGGQAIVEDQIPPSNLETVPVENNHGFHEKTAALKLEAEGEAMEDAAAPGDDRGGTQEPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: NDUFV3
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human cerebral cortex, colon, kidney and liver using Anti-NDUFV3 antibody HPA019791 (A) shows similar protein distribution across tissues to independent antibody HPA020463 (B).
Immunohistochemical staining of human kidney using Anti-NDUFV3 antibody HPA019791.
Immunohistochemical staining of human liver using Anti-NDUFV3 antibody HPA019791.
Immunohistochemical staining of human cerebral cortex using Anti-NDUFV3 antibody HPA019791.
Immunohistochemical staining of human colon using Anti-NDUFV3 antibody HPA019791.
Western blot analysis in control (vector only transfected HEK293T lysate) and NDUFV3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412100).
HPA019791-100ul
HPA019791-100ul
HPA019791-100ul