Anti-NDUFV3 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA019791
- Bilder (9)
| Artikelname: | Anti-NDUFV3 Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA019791 |
| Hersteller Artikelnummer: | HPA019791 |
| Alternativnummer: | ATA-HPA019791-100,ATA-HPA019791-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CI-10k |
| NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa |
| Anti-NDUFV3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 4731 |
| UniProt: | P56181 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PPLPRKETSGTQGIEGHLKGGQAIVEDQIPPSNLETVPVENNHGFHEKTAALKLEAEGEAMEDAAAPGDDRGGTQEPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | NDUFV3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex, colon, kidney and liver using Anti-NDUFV3 antibody HPA019791 (A) shows similar protein distribution across tissues to independent antibody HPA020463 (B). |
|
|
Immunohistochemical staining of human kidney using Anti-NDUFV3 antibody HPA019791. |
|
|
Immunohistochemical staining of human liver using Anti-NDUFV3 antibody HPA019791. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-NDUFV3 antibody HPA019791. |
|
|
Immunohistochemical staining of human colon using Anti-NDUFV3 antibody HPA019791. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and NDUFV3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412100). |
|
|
HPA019791 |
|
|
HPA019791 |
|
|
HPA019791 |
Produktgarantie und fachkundiger Support
