Anti-NDUFV3 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA019791
- Images (9)
| Article Name: | Anti-NDUFV3 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA019791 |
| Supplier Catalog Number: | HPA019791 |
| Alternative Catalog Number: | ATA-HPA019791-100,ATA-HPA019791-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CI-10k |
| NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa |
| Anti-NDUFV3 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 4731 |
| UniProt: | P56181 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PPLPRKETSGTQGIEGHLKGGQAIVEDQIPPSNLETVPVENNHGFHEKTAALKLEAEGEAMEDAAAPGDDRGGTQEPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NDUFV3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex, colon, kidney and liver using Anti-NDUFV3 antibody HPA019791 (A) shows similar protein distribution across tissues to independent antibody HPA020463 (B). |
|
|
Immunohistochemical staining of human kidney using Anti-NDUFV3 antibody HPA019791. |
|
|
Immunohistochemical staining of human liver using Anti-NDUFV3 antibody HPA019791. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-NDUFV3 antibody HPA019791. |
|
|
Immunohistochemical staining of human colon using Anti-NDUFV3 antibody HPA019791. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and NDUFV3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412100). |
|
|
HPA019791 |
|
|
HPA019791 |
|
|
HPA019791 |
Product Guarantee and Expert Support
