Anti-RBM15 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA019824
Artikelname: Anti-RBM15 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA019824
Hersteller Artikelnummer: HPA019824
Alternativnummer: ATA-HPA019824-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: OTT, OTT1
RNA binding motif protein 15
Anti-RBM15
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 64783
UniProt: Q96T37
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: DTYPPSASVVGASVGGHRHPPGGGGGQRSLSPGGAALGYRDYRLQQLALGRLPPPPPPPLPRDLERERDYPFYERVRPAYSLEPRVGAGAGAAPFREVDEISPEDDQRANRTLFL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RBM15
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
Western blot analysis in human cell line K562.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA019824
HPA019824
HPA019824