Anti-RBM15
Catalog Number:
ATA-HPA019824
- Images (9)
| Article Name: | Anti-RBM15 |
| Biozol Catalog Number: | ATA-HPA019824 |
| Supplier Catalog Number: | HPA019824 |
| Alternative Catalog Number: | ATA-HPA019824-100,ATA-HPA019824-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | OTT, OTT1 |
| RNA binding motif protein 15 |
| Anti-RBM15 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 64783 |
| UniProt: | Q96T37 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DTYPPSASVVGASVGGHRHPPGGGGGQRSLSPGGAALGYRDYRLQQLALGRLPPPPPPPLPRDLERERDYPFYERVRPAYSLEPRVGAGAGAAPFREVDEISPEDDQRANRTLFL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RBM15 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |









