Anti-RBM15 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-RBM15 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA019824
• Supplier Catalog Number: HPA019824
• Alternative Catalog Number: ATA-HPA019824-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: OTT, OTT1

Product Description

RNA binding motif protein 15

Additional Information

Anti-RBM15

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 64783
• UniProt: Q96T37
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: DTYPPSASVVGASVGGHRHPPGGGGGQRSLSPGGAALGYRDYRLQQLALGRLPPPPPPPLPRDLERERDYPFYERVRPAYSLEPRVGAGAGAAPFREVDEISPEDDQRANRTLFL
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: RBM15
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.

Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.

Western blot analysis in human cell line K562.

Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

HPA019824

HPA019824

HPA019824