Anti-NAPEPLD

Artikelnummer: ATA-HPA019832
Artikelname: Anti-NAPEPLD
Artikelnummer: ATA-HPA019832
Hersteller Artikelnummer: HPA019832
Alternativnummer: ATA-HPA019832-100,ATA-HPA019832-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C7orf18, FMP30, NAPE-PLD
N-acyl phosphatidylethanolamine phospholipase D
Anti-NAPEPLD
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 222236
UniProt: Q6IQ20
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: MKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALANEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNDDE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: NAPEPLD
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemical staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemical staining of human pancreas shows low positivity in exocrine glandular cells as expected.
Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
HPA019832-100ul
HPA019832-100ul
HPA019832-100ul