Anti-NAPEPLD Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA019832
- Images (9)
| Article Name: | Anti-NAPEPLD Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA019832 |
| Supplier Catalog Number: | HPA019832 |
| Alternative Catalog Number: | ATA-HPA019832-100,ATA-HPA019832-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C7orf18, FMP30, NAPE-PLD |
| N-acyl phosphatidylethanolamine phospholipase D |
| Anti-NAPEPLD |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 222236 |
| UniProt: | Q6IQ20 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALANEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNDDE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NAPEPLD |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. |
|
|
Immunohistochemical staining of human cerebral cortex shows weak cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human pancreas shows low positivity in exocrine glandular cells as expected. |
|
|
Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts. |
|
|
HPA019832 |
|
|
|
|
|
HPA019832 |
|
|
HPA019832 |
Product Guarantee and Expert Support
