Anti-NAPEPLD

Catalog Number: ATA-HPA019832
Article Name: Anti-NAPEPLD
Biozol Catalog Number: ATA-HPA019832
Supplier Catalog Number: HPA019832
Alternative Catalog Number: ATA-HPA019832-100,ATA-HPA019832-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C7orf18, FMP30, NAPE-PLD
N-acyl phosphatidylethanolamine phospholipase D
Anti-NAPEPLD
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 222236
UniProt: Q6IQ20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALANEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNDDE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: NAPEPLD
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemical staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemical staining of human pancreas shows low positivity in exocrine glandular cells as expected.
Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
HPA019832-100ul
HPA019832-100ul
HPA019832-100ul