Anti-PCNT Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA019887
- Bilder (9)
| Artikelname: | Anti-PCNT Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA019887 |
| Hersteller Artikelnummer: | HPA019887 |
| Alternativnummer: | ATA-HPA019887-100,ATA-HPA019887-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KEN, KIAA0402, PCN, PCNT2, PCNTB, SCKL4 |
| pericentrin |
| Anti-PCNT |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5116 |
| UniProt: | O95613 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MLDLSSWSSPEVLRKDWTLEPWPSLPVTPHSGALSLCSADTSLGDRADTSLPQTQGPGLLCSPGVSAAALALQWAESPPADDHHVQRTAVEKDVEDFITTSFDSQETLSSPPPGLEGKADRSEKSDGSG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PCNT |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome. |
|
|
Immunohistochemistry analysis in human testis and liver tissues using Anti-PCNT antibody. Corresponding PCNT RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human gallbladder, liver, lymph node and testis using Anti-PCNT antibody HPA019887 (A) shows similar protein distribution across tissues to independent antibody HPA016820 (B). |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human lymph node using Anti-PCNT antibody HPA019887. |
|
|
Immunohistochemical staining of human gallbladder using Anti-PCNT antibody HPA019887. |
|
|
|
|
|
HPA019887 |
Produktgarantie und fachkundiger Support
