Anti-PCNT

Catalog Number: ATA-HPA019887
Article Name: Anti-PCNT
Biozol Catalog Number: ATA-HPA019887
Supplier Catalog Number: HPA019887
Alternative Catalog Number: ATA-HPA019887-100,ATA-HPA019887-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KEN, KIAA0402, PCN, PCNT2, PCNTB, SCKL4
pericentrin
Anti-PCNT
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 5116
UniProt: O95613
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MLDLSSWSSPEVLRKDWTLEPWPSLPVTPHSGALSLCSADTSLGDRADTSLPQTQGPGLLCSPGVSAAALALQWAESPPADDHHVQRTAVEKDVEDFITTSFDSQETLSSPPPGLEGKADRSEKSDGSG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PCNT
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome.
Immunohistochemistry analysis in human testis and liver tissues using Anti-PCNT antibody. Corresponding PCNT RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human gallbladder, liver, lymph node and testis using Anti-PCNT antibody HPA019887 (A) shows similar protein distribution across tissues to independent antibody HPA016820 (B).
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human lymph node using Anti-PCNT antibody HPA019887.
Immunohistochemical staining of human gallbladder using Anti-PCNT antibody HPA019887.
HPA019887-100ul