Anti-PCNT Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA019887
- Images (9)
| Article Name: | Anti-PCNT Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA019887 |
| Supplier Catalog Number: | HPA019887 |
| Alternative Catalog Number: | ATA-HPA019887-100,ATA-HPA019887-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KEN, KIAA0402, PCN, PCNT2, PCNTB, SCKL4 |
| pericentrin |
| Anti-PCNT |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 5116 |
| UniProt: | O95613 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MLDLSSWSSPEVLRKDWTLEPWPSLPVTPHSGALSLCSADTSLGDRADTSLPQTQGPGLLCSPGVSAAALALQWAESPPADDHHVQRTAVEKDVEDFITTSFDSQETLSSPPPGLEGKADRSEKSDGSG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PCNT |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome. |
|
|
Immunohistochemistry analysis in human testis and liver tissues using Anti-PCNT antibody. Corresponding PCNT RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human gallbladder, liver, lymph node and testis using Anti-PCNT antibody HPA019887 (A) shows similar protein distribution across tissues to independent antibody HPA016820 (B). |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human lymph node using Anti-PCNT antibody HPA019887. |
|
|
Immunohistochemical staining of human gallbladder using Anti-PCNT antibody HPA019887. |
|
|
|
|
|
HPA019887 |
Product Guarantee and Expert Support
