Anti-CCDC155
Artikelnummer:
ATA-HPA019937
- Bilder (8)
| Artikelname: | Anti-CCDC155 |
| Artikelnummer: | ATA-HPA019937 |
| Hersteller Artikelnummer: | HPA019937 |
| Alternativnummer: | ATA-HPA019937-100,ATA-HPA019937-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ32658, KASH5 |
| coiled-coil domain containing 155 |
| Anti-CCDC155 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 147872 |
| UniProt: | Q8N6L0 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EENGKLLAERDGVKKRSQELAMEKDTLKRQLFECEHLICQRDTILSERTRDVESLAQTLEEYRVTTQELRLEISRLEEQLSQTYEGPDELPEGA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CCDC155 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human cerebral cortex, colon, lymph node and testis using Anti-CCDC155 antibody HPA019937 (A) shows similar protein distribution across tissues to independent antibody HPA019940 (B). |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-CCDC155 antibody HPA019937. |
|
|
Immunohistochemical staining of human testis using Anti-CCDC155 antibody HPA019937. |
|
|
Immunohistochemical staining of human lymph node using Anti-CCDC155 antibody HPA019937. |
|
|
Immunohistochemical staining of human colon using Anti-CCDC155 antibody HPA019937. |
|
|
HPA019937-100ul |
|
|
HPA019937-100ul |
|
|
HPA019937-100ul |
Produktgarantie und fachkundiger Support
