Anti-CCDC155
Catalog Number:
ATA-HPA019937
- Images (8)
| Article Name: | Anti-CCDC155 |
| Biozol Catalog Number: | ATA-HPA019937 |
| Supplier Catalog Number: | HPA019937 |
| Alternative Catalog Number: | ATA-HPA019937-100,ATA-HPA019937-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ32658, KASH5 |
| coiled-coil domain containing 155 |
| Anti-CCDC155 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 147872 |
| UniProt: | Q8N6L0 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EENGKLLAERDGVKKRSQELAMEKDTLKRQLFECEHLICQRDTILSERTRDVESLAQTLEEYRVTTQELRLEISRLEEQLSQTYEGPDELPEGA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CCDC155 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human cerebral cortex, colon, lymph node and testis using Anti-CCDC155 antibody HPA019937 (A) shows similar protein distribution across tissues to independent antibody HPA019940 (B). |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-CCDC155 antibody HPA019937. |
|
|
Immunohistochemical staining of human testis using Anti-CCDC155 antibody HPA019937. |
|
|
Immunohistochemical staining of human lymph node using Anti-CCDC155 antibody HPA019937. |
|
|
Immunohistochemical staining of human colon using Anti-CCDC155 antibody HPA019937. |
|
|
HPA019937-100ul |
|
|
HPA019937-100ul |
|
|
HPA019937-100ul |
Product Guarantee and Expert Support
