Anti-DDX25

Artikelnummer: ATA-HPA020137
Artikelname: Anti-DDX25
Artikelnummer: ATA-HPA020137
Hersteller Artikelnummer: HPA020137
Alternativnummer: ATA-HPA020137-100,ATA-HPA020137-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: GRTH
DEAD (Asp-Glu-Ala-Asp) box helicase 25
Anti-DDX25
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 29118
UniProt: Q9UHL0
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: NSHFSNLSQPRKNLWGIKSTAVRNIDGSINNINEDDEEDVVDLAANSLLNKLIHQSLVESSHRVEVLQKDPSSP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DDX25
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human testis and endometrium tissues using Anti-DDX25 antibody. Corresponding DDX25 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human hypothalamus shows strong cytoplasmic positivity in subsets of glial cells and in processes.
Immunohistochemical staining of human endometrium shows low expression as expected.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA020137-100ul
HPA020137-100ul
HPA020137-100ul