Anti-DDX25 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA020137
- Bilder (9)
| Artikelname: | Anti-DDX25 Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA020137 |
| Hersteller Artikelnummer: | HPA020137 |
| Alternativnummer: | ATA-HPA020137-100,ATA-HPA020137-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GRTH |
| DEAD (Asp-Glu-Ala-Asp) box helicase 25 |
| Anti-DDX25 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 29118 |
| UniProt: | Q9UHL0 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | NSHFSNLSQPRKNLWGIKSTAVRNIDGSINNINEDDEEDVVDLAANSLLNKLIHQSLVESSHRVEVLQKDPSSP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DDX25 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human testis and endometrium tissues using Anti-DDX25 antibody. Corresponding DDX25 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human hypothalamus shows strong cytoplasmic positivity in subsets of glial cells and in processes. |
|
|
Immunohistochemical staining of human endometrium shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 |
|
|
HPA020137 |
|
|
|
|
|
HPA020137 |
|
|
HPA020137 |
Produktgarantie und fachkundiger Support
