Anti-DDX25 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA020137
- Images (9)
| Article Name: | Anti-DDX25 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA020137 |
| Supplier Catalog Number: | HPA020137 |
| Alternative Catalog Number: | ATA-HPA020137-100,ATA-HPA020137-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | GRTH |
| DEAD (Asp-Glu-Ala-Asp) box helicase 25 |
| Anti-DDX25 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 29118 |
| UniProt: | Q9UHL0 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NSHFSNLSQPRKNLWGIKSTAVRNIDGSINNINEDDEEDVVDLAANSLLNKLIHQSLVESSHRVEVLQKDPSSP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DDX25 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human testis and endometrium tissues using Anti-DDX25 antibody. Corresponding DDX25 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human hypothalamus shows strong cytoplasmic positivity in subsets of glial cells and in processes. |
|
|
Immunohistochemical staining of human endometrium shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 |
|
|
HPA020137 |
|
|
|
|
|
HPA020137 |
|
|
HPA020137 |
Product Guarantee and Expert Support
