Anti-DDX25

Catalog Number: ATA-HPA020137
Article Name: Anti-DDX25
Biozol Catalog Number: ATA-HPA020137
Supplier Catalog Number: HPA020137
Alternative Catalog Number: ATA-HPA020137-100,ATA-HPA020137-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GRTH
DEAD (Asp-Glu-Ala-Asp) box helicase 25
Anti-DDX25
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 29118
UniProt: Q9UHL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NSHFSNLSQPRKNLWGIKSTAVRNIDGSINNINEDDEEDVVDLAANSLLNKLIHQSLVESSHRVEVLQKDPSSP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: DDX25
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human testis and endometrium tissues using Anti-DDX25 antibody. Corresponding DDX25 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human hypothalamus shows strong cytoplasmic positivity in subsets of glial cells and in processes.
Immunohistochemical staining of human endometrium shows low expression as expected.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA020137-100ul
HPA020137-100ul
HPA020137-100ul