Anti-AKR1B10
Artikelnummer:
ATA-HPA020280
- Bilder (7)
| Artikelname: | Anti-AKR1B10 |
| Artikelnummer: | ATA-HPA020280 |
| Hersteller Artikelnummer: | HPA020280 |
| Alternativnummer: | ATA-HPA020280-100,ATA-HPA020280-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | AKR1B11, AKR1B12, ALDRLn, ARL-1, ARL1, HIS, HSI |
| aldo-keto reductase family 1, member B10 (aldose reductase) |
| Anti-AKR1B10 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 57016 |
| UniProt: | O60218 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKAT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | AKR1B10 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A549 shows localization to plasma membrane & cytosol. |
|
|
Immunohistochemical staining of human small intestine shows strong cytoplasmic, nuclear and membranous positivity in glandular cells. |
|
|
Western blot analysis in human cell lines A-549 and HEK293 using Anti-AKR1B10 antibody. Corresponding AKR1B10 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 |
|
|
HPA020280-100ul |
|
|
HPA020280-100ul |
|
|
HPA020280-100ul |
Produktgarantie und fachkundiger Support
