Anti-AKR1B10
Catalog Number:
ATA-HPA020280
- Images (7)
| Article Name: | Anti-AKR1B10 |
| Biozol Catalog Number: | ATA-HPA020280 |
| Supplier Catalog Number: | HPA020280 |
| Alternative Catalog Number: | ATA-HPA020280-100,ATA-HPA020280-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | AKR1B11, AKR1B12, ALDRLn, ARL-1, ARL1, HIS, HSI |
| aldo-keto reductase family 1, member B10 (aldose reductase) |
| Anti-AKR1B10 |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 57016 |
| UniProt: | O60218 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKAT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | AKR1B10 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A549 shows localization to plasma membrane & cytosol. |
|
|
Immunohistochemical staining of human small intestine shows strong cytoplasmic, nuclear and membranous positivity in glandular cells. |
|
|
Western blot analysis in human cell lines A-549 and HEK293 using Anti-AKR1B10 antibody. Corresponding AKR1B10 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 |
|
|
HPA020280-100ul |
|
|
HPA020280-100ul |
|
|
HPA020280-100ul |
Product Guarantee and Expert Support
