Anti-AKR1B10

Catalog Number: ATA-HPA020280
Article Name: Anti-AKR1B10
Biozol Catalog Number: ATA-HPA020280
Supplier Catalog Number: HPA020280
Alternative Catalog Number: ATA-HPA020280-100,ATA-HPA020280-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: AKR1B11, AKR1B12, ALDRLn, ARL-1, ARL1, HIS, HSI
aldo-keto reductase family 1, member B10 (aldose reductase)
Anti-AKR1B10
Clonality: Polyclonal
Concentration: 0.4 mg/ml
Isotype: IgG
NCBI: 57016
UniProt: O60218
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKAT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: AKR1B10
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A549 shows localization to plasma membrane & cytosol.
Immunohistochemical staining of human small intestine shows strong cytoplasmic, nuclear and membranous positivity in glandular cells.
Western blot analysis in human cell lines A-549 and HEK293 using Anti-AKR1B10 antibody. Corresponding AKR1B10 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA020280-100ul
HPA020280-100ul
HPA020280-100ul