Anti-CPA2 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA020342
Artikelname: Anti-CPA2 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA020342
Hersteller Artikelnummer: HPA020342
Alternativnummer: ATA-HPA020342-100,ATA-HPA020342-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CPA2
carboxypeptidase A2 (pancreatic)
Anti-CPA2
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 1358
UniProt: P48052
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: MIEDVQVLLDKENEEMLFNRRRERSGNFNFGAYHTLEEISQEMDNLVAEHPGLVSKVNIGSSFENRPMNV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CPA2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human pancreas and liver tissues using Anti-CPA2 antibody. Corresponding CPA2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney, liver, pancreas and testis using Anti-CPA2 antibody HPA020342 (A) shows similar protein distribution across tissues to independent antibody HPA021317 (B).
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human pancreas shows high expression.
Immunohistochemical staining of human testis using Anti-CPA2 antibody HPA020342.
Immunohistochemical staining of human kidney using Anti-CPA2 antibody HPA020342.
HPA020342
HPA020342
HPA020342