Anti-CPA2

Catalog Number: ATA-HPA020342
Article Name: Anti-CPA2
Biozol Catalog Number: ATA-HPA020342
Supplier Catalog Number: HPA020342
Alternative Catalog Number: ATA-HPA020342-100,ATA-HPA020342-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CPA2
carboxypeptidase A2 (pancreatic)
Anti-CPA2
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 1358
UniProt: P48052
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MIEDVQVLLDKENEEMLFNRRRERSGNFNFGAYHTLEEISQEMDNLVAEHPGLVSKVNIGSSFENRPMNV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CPA2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human pancreas and liver tissues using Anti-CPA2 antibody. Corresponding CPA2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney, liver, pancreas and testis using Anti-CPA2 antibody HPA020342 (A) shows similar protein distribution across tissues to independent antibody HPA021317 (B).
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human pancreas shows high expression.
Immunohistochemical staining of human testis using Anti-CPA2 antibody HPA020342.
Immunohistochemical staining of human kidney using Anti-CPA2 antibody HPA020342.
HPA020342-100ul
HPA020342-100ul
HPA020342-100ul