Anti-CPA2 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA020342
- Images (9)
| Article Name: | Anti-CPA2 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA020342 |
| Supplier Catalog Number: | HPA020342 |
| Alternative Catalog Number: | ATA-HPA020342-100,ATA-HPA020342-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CPA2 |
| carboxypeptidase A2 (pancreatic) |
| Anti-CPA2 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 1358 |
| UniProt: | P48052 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MIEDVQVLLDKENEEMLFNRRRERSGNFNFGAYHTLEEISQEMDNLVAEHPGLVSKVNIGSSFENRPMNV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CPA2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human pancreas and liver tissues using Anti-CPA2 antibody. Corresponding CPA2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney, liver, pancreas and testis using Anti-CPA2 antibody HPA020342 (A) shows similar protein distribution across tissues to independent antibody HPA021317 (B). |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human pancreas shows high expression. |
|
|
Immunohistochemical staining of human testis using Anti-CPA2 antibody HPA020342. |
|
|
Immunohistochemical staining of human kidney using Anti-CPA2 antibody HPA020342. |
|
|
HPA020342 |
|
|
HPA020342 |
|
|
HPA020342 |
Product Guarantee and Expert Support
