Anti-CAPN9
Artikelnummer:
ATA-HPA020398
- Bilder (8)
| Artikelname: | Anti-CAPN9 |
| Artikelnummer: | ATA-HPA020398 |
| Hersteller Artikelnummer: | HPA020398 |
| Alternativnummer: | ATA-HPA020398-100,ATA-HPA020398-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GC36, nCL-4 |
| calpain 9 |
| Anti-CAPN9 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10753 |
| UniProt: | O14815 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PGEYILIPSTFEPHQEADFCLRIFSEKKAITRDMDGNVDIDLPEPPKPTPPDQETEEEQRFRALFEQVAGEDMEVTAEELEYVLNAVLQKKKDIKFKKLS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CAPN9 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human stomach and pancreas tissues using HPA020398 antibody. Corresponding CAPN9 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Immunohistochemical staining of human fallopian tube shows weak cytoplasmic positivity in glandular cells as expected. |
|
|
Immunohistochemical staining of human stomach shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
HPA020398-100ul |
|
|
HPA020398-100ul |
|
|
HPA020398-100ul |
Produktgarantie und fachkundiger Support
