Anti-CAPN9
Catalog Number:
ATA-HPA020398
- Images (8)
| Article Name: | Anti-CAPN9 |
| Biozol Catalog Number: | ATA-HPA020398 |
| Supplier Catalog Number: | HPA020398 |
| Alternative Catalog Number: | ATA-HPA020398-100,ATA-HPA020398-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | GC36, nCL-4 |
| calpain 9 |
| Anti-CAPN9 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 10753 |
| UniProt: | O14815 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PGEYILIPSTFEPHQEADFCLRIFSEKKAITRDMDGNVDIDLPEPPKPTPPDQETEEEQRFRALFEQVAGEDMEVTAEELEYVLNAVLQKKKDIKFKKLS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CAPN9 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human stomach and pancreas tissues using HPA020398 antibody. Corresponding CAPN9 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Immunohistochemical staining of human fallopian tube shows weak cytoplasmic positivity in glandular cells as expected. |
|
|
Immunohistochemical staining of human stomach shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
HPA020398-100ul |
|
|
HPA020398-100ul |
|
|
HPA020398-100ul |
Product Guarantee and Expert Support
