Anti-RASAL2
Artikelnummer:
ATA-HPA020453
| Artikelname: |
Anti-RASAL2 |
| Artikelnummer: |
ATA-HPA020453 |
| Hersteller Artikelnummer: |
HPA020453 |
| Alternativnummer: |
ATA-HPA020453-100,ATA-HPA020453-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human, Mouse |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
nGAP |
| RAS protein activator like 2 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.2 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
9462 |
| UniProt: |
Q9UJF2 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
LSVLHSLLWEVVSQLDKATVAKLGPLPRVLADITKSLTNPTPIQQQLRRFTEHNSSPNVSGSLSSGLQKIFEDPT |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
RASAL2 |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons. |
|
Western blot analysis in human cell line A-431. |
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 |
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
HPA020453-100ul |
|
HPA020453-100ul |
|
HPA020453-100ul |