Anti-RASAL2

Catalog Number: ATA-HPA020453
Article Name: Anti-RASAL2
Biozol Catalog Number: ATA-HPA020453
Supplier Catalog Number: HPA020453
Alternative Catalog Number: ATA-HPA020453-100,ATA-HPA020453-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: nGAP
RAS protein activator like 2
Anti-RASAL2
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 9462
UniProt: Q9UJF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LSVLHSLLWEVVSQLDKATVAKLGPLPRVLADITKSLTNPTPIQQQLRRFTEHNSSPNVSGSLSSGLQKIFEDPT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RASAL2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Western blot analysis in human cell line A-431.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA020453-100ul
HPA020453-100ul
HPA020453-100ul