Anti-DNAJC2

Artikelnummer: ATA-HPA020454
Artikelname: Anti-DNAJC2
Artikelnummer: ATA-HPA020454
Hersteller Artikelnummer: HPA020454
Alternativnummer: ATA-HPA020454-100,ATA-HPA020454-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Molekularbiologie
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MPHOSPH11, MPP11, ZRF1, ZUO1, zuotin
DnaJ (Hsp40) homolog, subfamily C, member 2
Anti-DNAJC2
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 27000
UniProt: Q99543
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EEINEQIRKEKEEAEARMRQASKNTEKSTGGGGNGSKNWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTAKDV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DNAJC2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemical staining of human prostate shows weak cytoplasmic positivity in smooth muscle cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA020454-100ul
HPA020454-100ul
HPA020454-100ul