Anti-DNAJC2

Product Overview

• Article Name: Anti-DNAJC2
• Biozol Catalog Number: ATA-HPA020454
• Supplier Catalog Number: HPA020454
• Alternative Catalog Number: ATA-HPA020454-100,ATA-HPA020454-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Molekularbiologie
• Application: ICC, IHC, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: MPHOSPH11, MPP11, ZRF1, ZUO1, zuotin

Product Description

DnaJ (Hsp40) homolog, subfamily C, member 2

Additional Information

Anti-DNAJC2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.3 mg/ml
• Isotype: IgG
• NCBI: 27000
• UniProt: Q99543
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: EEINEQIRKEKEEAEARMRQASKNTEKSTGGGGNGSKNWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTAKDV
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: DNAJC2
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemical staining of human prostate shows weak cytoplasmic positivity in smooth muscle cells.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

HPA020454-100ul

HPA020454-100ul

HPA020454-100ul