Anti-PLAA
Artikelnummer:
ATA-HPA020996
| Artikelname: |
Anti-PLAA |
| Artikelnummer: |
ATA-HPA020996 |
| Hersteller Artikelnummer: |
HPA020996 |
| Alternativnummer: |
ATA-HPA020996-100,ATA-HPA020996-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
ICC, IHC, WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
DOA1, FLJ11281, FLJ12699, PLA2P, PLAP |
| phospholipase A2-activating protein |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.3 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
9373 |
| UniProt: |
Q9Y263 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
EGKEFDYVFSIDVNEGGPSYKLPYNTSDDPWLTAYNFLQKNDLNPMFLDQVAKFIIDNTKGQMLGLGNPSFSDPFTGGGRYVPGSSGSSNTLPTADP |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
PLAA |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol. |
|
Immunohistochemical staining of human testis shows strong positivity in a subset of cells in seminiferus ducts. |
|
Western blot analysis using Anti-PLAA antibody HPA020996 (A) shows similar pattern to independent antibody HPA020994 (B). |
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
HPA020996-100ul |
|
|
|
|
|
HPA020996-100ul |
|
HPA020996-100ul |