Anti-PLAA

Catalog Number: ATA-HPA020996
Article Name: Anti-PLAA
Biozol Catalog Number: ATA-HPA020996
Supplier Catalog Number: HPA020996
Alternative Catalog Number: ATA-HPA020996-100,ATA-HPA020996-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DOA1, FLJ11281, FLJ12699, PLA2P, PLAP
phospholipase A2-activating protein
Anti-PLAA
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 9373
UniProt: Q9Y263
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EGKEFDYVFSIDVNEGGPSYKLPYNTSDDPWLTAYNFLQKNDLNPMFLDQVAKFIIDNTKGQMLGLGNPSFSDPFTGGGRYVPGSSGSSNTLPTADP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PLAA
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.
Immunohistochemical staining of human testis shows strong positivity in a subset of cells in seminiferus ducts.
Western blot analysis using Anti-PLAA antibody HPA020996 (A) shows similar pattern to independent antibody HPA020994 (B).
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA020996-100ul
HPA020996-100ul
HPA020996-100ul