Anti-MPO
Artikelnummer:
ATA-HPA021147
- Bilder (9)
| Artikelname: | Anti-MPO |
| Artikelnummer: | ATA-HPA021147 |
| Hersteller Artikelnummer: | HPA021147 |
| Alternativnummer: | ATA-HPA021147-100,ATA-HPA021147-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MPO |
| myeloperoxidase |
| Anti-MPO |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 4353 |
| UniProt: | P05164 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNC |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MPO |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:5000 - 1:10000 |
|
|
Immunohistochemistry analysis in human bone marrow and cerebral cortex tissues using Anti-MPO antibody. Corresponding MPO RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human bone marrow, cerebral cortex, liver and testis using Anti-MPO antibody HPA021147 (A) shows similar protein distribution across tissues to independent antibody HPA061464 (B). |
|
|
Immunohistochemical staining of human bone marrow shows high expression. |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
Immunohistochemical staining of human testis using Anti-MPO antibody HPA021147. |
|
|
Immunohistochemical staining of human liver using Anti-MPO antibody HPA021147. |
|
|
HPA021147-100ul |
|
|
HPA021147-100ul |
|
|
HPA021147-100ul |
Produktgarantie und fachkundiger Support
