Anti-MPO
Catalog Number:
ATA-HPA021147
- Images (9)
| Article Name: | Anti-MPO |
| Biozol Catalog Number: | ATA-HPA021147 |
| Supplier Catalog Number: | HPA021147 |
| Alternative Catalog Number: | ATA-HPA021147-100,ATA-HPA021147-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MPO |
| myeloperoxidase |
| Anti-MPO |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 4353 |
| UniProt: | P05164 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNC |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MPO |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:5000 - 1:10000 |
|
|
Immunohistochemistry analysis in human bone marrow and cerebral cortex tissues using Anti-MPO antibody. Corresponding MPO RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human bone marrow, cerebral cortex, liver and testis using Anti-MPO antibody HPA021147 (A) shows similar protein distribution across tissues to independent antibody HPA061464 (B). |
|
|
Immunohistochemical staining of human bone marrow shows high expression. |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
Immunohistochemical staining of human testis using Anti-MPO antibody HPA021147. |
|
|
Immunohistochemical staining of human liver using Anti-MPO antibody HPA021147. |
|
|
HPA021147-100ul |
|
|
HPA021147-100ul |
|
|
HPA021147-100ul |
Product Guarantee and Expert Support
