Anti-ENTPD8
Artikelnummer:
ATA-HPA021509
- Bilder (8)
| Artikelname: | Anti-ENTPD8 |
| Artikelnummer: | ATA-HPA021509 |
| Hersteller Artikelnummer: | HPA021509 |
| Alternativnummer: | ATA-HPA021509-100,ATA-HPA021509-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | NTPDase-8, UNQ2492 |
| ectonucleoside triphosphate diphosphohydrolase 8 |
| Anti-ENTPD8 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 377841 |
| UniProt: | Q5MY95 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SHTSLFLYQWPANKENGTGVVSQALACQVEGPGISSYTSNAAQAGESLQGCLEEALVLIPEAQHRKTPTFLGATAGMRLLSRKNSSQARDIFAAVTQVLGRSPVDFWGAELLAGQAEGAFGWITVNYGLG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ENTPD8 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemistry analysis in human small intestine and pancreas tissues using Anti-ENTPD8 antibody. Corresponding ENTPD8 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human small intestine shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
HPA021509-100ul |
|
|
|
|
|
HPA021509-100ul |
|
|
HPA021509-100ul |
Produktgarantie und fachkundiger Support
