Anti-ENTPD8

Catalog Number: ATA-HPA021509
Article Name: Anti-ENTPD8
Biozol Catalog Number: ATA-HPA021509
Supplier Catalog Number: HPA021509
Alternative Catalog Number: ATA-HPA021509-100,ATA-HPA021509-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: NTPDase-8, UNQ2492
ectonucleoside triphosphate diphosphohydrolase 8
Anti-ENTPD8
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 377841
UniProt: Q5MY95
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SHTSLFLYQWPANKENGTGVVSQALACQVEGPGISSYTSNAAQAGESLQGCLEEALVLIPEAQHRKTPTFLGATAGMRLLSRKNSSQARDIFAAVTQVLGRSPVDFWGAELLAGQAEGAFGWITVNYGLG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ENTPD8
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry analysis in human small intestine and pancreas tissues using Anti-ENTPD8 antibody. Corresponding ENTPD8 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human small intestine shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA021509-100ul
HPA021509-100ul
HPA021509-100ul