Anti-PPT1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA021546
Artikelname: Anti-PPT1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA021546
Hersteller Artikelnummer: HPA021546
Alternativnummer: ATA-HPA021546-100,ATA-HPA021546-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CLN1, INCL, PPT
palmitoyl-protein thioesterase 1
Anti-PPT1
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 5538
UniProt: P50897
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFY
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PPT1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human cerebral cortex shows very strong granular positivity in cytoplasm in neurons.
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemical staining of human prostate shows strong granular positivity in cytoplasm in glandular cells.
Immunohistochemical staining of human lung shows very strong granular positivity in cytoplasm in macrophages.
Western blot analysis in human cell line THP-1.
HPA021546
HPA021546
HPA021546