Anti-PPT1 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA021546
- Images (9)
| Article Name: | Anti-PPT1 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA021546 |
| Supplier Catalog Number: | HPA021546 |
| Alternative Catalog Number: | ATA-HPA021546-100,ATA-HPA021546-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CLN1, INCL, PPT |
| palmitoyl-protein thioesterase 1 |
| Anti-PPT1 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 5538 |
| UniProt: | P50897 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFY |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PPT1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex shows very strong granular positivity in cytoplasm in neurons. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
Immunohistochemical staining of human prostate shows strong granular positivity in cytoplasm in glandular cells. |
|
|
Immunohistochemical staining of human lung shows very strong granular positivity in cytoplasm in macrophages. |
|
|
Western blot analysis in human cell line THP-1. |
|
|
HPA021546 |
|
|
|
|
|
HPA021546 |
|
|
HPA021546 |
Product Guarantee and Expert Support
