Anti-PPT1

Catalog Number: ATA-HPA021546
Article Name: Anti-PPT1
Biozol Catalog Number: ATA-HPA021546
Supplier Catalog Number: HPA021546
Alternative Catalog Number: ATA-HPA021546-100,ATA-HPA021546-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CLN1, INCL, PPT
palmitoyl-protein thioesterase 1
Anti-PPT1
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 5538
UniProt: P50897
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFY
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PPT1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human cerebral cortex shows very strong granular positivity in cytoplasm in neurons.
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemical staining of human prostate shows strong granular positivity in cytoplasm in glandular cells.
Immunohistochemical staining of human lung shows very strong granular positivity in cytoplasm in macrophages.
Western blot analysis in human cell line THP-1.
HPA021546-100ul
HPA021546-100ul
HPA021546-100ul