Anti-SLC43A2
Artikelnummer:
ATA-HPA021564
- Bilder (8)
| Artikelname: | Anti-SLC43A2 |
| Artikelnummer: | ATA-HPA021564 |
| Hersteller Artikelnummer: | HPA021564 |
| Alternativnummer: | ATA-HPA021564-100,ATA-HPA021564-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MGC34680 |
| solute carrier family 43 (amino acid system L transporter), member 2 |
| Anti-SLC43A2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 124935 |
| UniProt: | Q8N370 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | YRRQLERQLQQRQEDDKLFLKINGSSNQEAFV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SLC43A2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human placenta and liver tissues using Anti-SLC43A2 antibody. Corresponding SLC43A2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human placenta shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Western blot analysis in human cell line RT-4. |
|
|
HPA021564-100ul |
|
|
|
|
|
HPA021564-100ul |
|
|
HPA021564-100ul |
Produktgarantie und fachkundiger Support
