Anti-SLC43A2
Catalog Number:
ATA-HPA021564
- Images (8)
| Article Name: | Anti-SLC43A2 |
| Biozol Catalog Number: | ATA-HPA021564 |
| Supplier Catalog Number: | HPA021564 |
| Alternative Catalog Number: | ATA-HPA021564-100,ATA-HPA021564-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MGC34680 |
| solute carrier family 43 (amino acid system L transporter), member 2 |
| Anti-SLC43A2 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 124935 |
| UniProt: | Q8N370 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | YRRQLERQLQQRQEDDKLFLKINGSSNQEAFV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLC43A2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human placenta and liver tissues using Anti-SLC43A2 antibody. Corresponding SLC43A2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human placenta shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Western blot analysis in human cell line RT-4. |
|
|
HPA021564-100ul |
|
|
|
|
|
HPA021564-100ul |
|
|
HPA021564-100ul |
Product Guarantee and Expert Support
