Anti-CTH Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA021591
Artikelname: Anti-CTH Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA021591
Hersteller Artikelnummer: HPA021591
Alternativnummer: ATA-HPA021591-100,ATA-HPA021591-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CTH
cystathionine gamma-lyase
Anti-CTH
Klonalität: Polyclonal
Konzentration: 0.4 mg/ml
Isotyp: IgG
NCBI: 1491
UniProt: P32929
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGAD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CTH
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50
Immunohistochemistry analysis in human liver and lymph node tissues using Anti-CTH antibody. Corresponding CTH RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human colon, liver, lymph node and testis using Anti-CTH antibody HPA021591 (A) shows similar protein distribution across tissues to independent antibody HPA023300 (B).
Immunohistochemical staining of human lymph node shows low expression as expected.
Immunohistochemical staining of human liver shows high expression.
Immunohistochemical staining of human testis using Anti-CTH antibody HPA021591.
Immunohistochemical staining of human colon using Anti-CTH antibody HPA021591.
HPA021591
HPA021591
HPA021591