Anti-CTH Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA021591
- Images (9)
| Article Name: | Anti-CTH Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA021591 |
| Supplier Catalog Number: | HPA021591 |
| Alternative Catalog Number: | ATA-HPA021591-100,ATA-HPA021591-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CTH |
| cystathionine gamma-lyase |
| Anti-CTH |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 1491 |
| UniProt: | P32929 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGAD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CTH |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human liver and lymph node tissues using Anti-CTH antibody. Corresponding CTH RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon, liver, lymph node and testis using Anti-CTH antibody HPA021591 (A) shows similar protein distribution across tissues to independent antibody HPA023300 (B). |
|
|
Immunohistochemical staining of human lymph node shows low expression as expected. |
|
|
Immunohistochemical staining of human liver shows high expression. |
|
|
Immunohistochemical staining of human testis using Anti-CTH antibody HPA021591. |
|
|
Immunohistochemical staining of human colon using Anti-CTH antibody HPA021591. |
|
|
HPA021591 |
|
|
HPA021591 |
|
|
HPA021591 |
Product Guarantee and Expert Support
