Anti-CTH

Catalog Number: ATA-HPA021591
Article Name: Anti-CTH
Biozol Catalog Number: ATA-HPA021591
Supplier Catalog Number: HPA021591
Alternative Catalog Number: ATA-HPA021591-100,ATA-HPA021591-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CTH
cystathionine gamma-lyase
Anti-CTH
Clonality: Polyclonal
Concentration: 0.4 mg/ml
Isotype: IgG
NCBI: 1491
UniProt: P32929
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGAD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CTH
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50
Immunohistochemistry analysis in human liver and lymph node tissues using Anti-CTH antibody. Corresponding CTH RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human colon, liver, lymph node and testis using Anti-CTH antibody HPA021591 (A) shows similar protein distribution across tissues to independent antibody HPA023300 (B).
Immunohistochemical staining of human lymph node shows low expression as expected.
Immunohistochemical staining of human liver shows high expression.
Immunohistochemical staining of human testis using Anti-CTH antibody HPA021591.
Immunohistochemical staining of human colon using Anti-CTH antibody HPA021591.
HPA021591-100ul
HPA021591-100ul
HPA021591-100ul