Anti-KLHL41 ChIP certified

Artikelnummer: ATA-HPA021760
Artikelname: Anti-KLHL41 ChIP certified
Artikelnummer: ATA-HPA021760
Hersteller Artikelnummer: HPA021760
Alternativnummer: ATA-HPA021760-100,ATA-HPA021760-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KBTBD10, Krp1, SARCOSIN
kelch-like family member 41
Anti-KLHL41
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 10324
UniProt: O60662
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SNDSLNVEKEEAVFEAVMKWVRTDKENRVKNLSEVFDCIRFRLMTEKYFKDHVEKDDIIKSNPDLQK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: KLHL41
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human skeletal muscle and liver tissues using Anti-KLHL41 antibody. Corresponding KLHL41 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human colon, liver, lymph node and skeletal muscle using Anti-KLHL41 antibody HPA021760 (A) shows similar protein distribution across tissues to independent antibody HPA021165 (B).
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human skeletal muscle shows high expression.
Immunohistochemical staining of human lymph node using Anti-KLHL41 antibody HPA021760.
Immunohistochemical staining of human colon using Anti-KLHL41 antibody HPA021760.
HPA021760-100ul
HPA021760-100ul
HPA021760-100ul