Anti-KLHL41 ChIP certified

Catalog Number: ATA-HPA021760
Article Name: Anti-KLHL41 ChIP certified
Biozol Catalog Number: ATA-HPA021760
Supplier Catalog Number: HPA021760
Alternative Catalog Number: ATA-HPA021760-100,ATA-HPA021760-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KBTBD10, Krp1, SARCOSIN
kelch-like family member 41
Anti-KLHL41
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 10324
UniProt: O60662
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SNDSLNVEKEEAVFEAVMKWVRTDKENRVKNLSEVFDCIRFRLMTEKYFKDHVEKDDIIKSNPDLQK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: KLHL41
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human skeletal muscle and liver tissues using Anti-KLHL41 antibody. Corresponding KLHL41 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human colon, liver, lymph node and skeletal muscle using Anti-KLHL41 antibody HPA021760 (A) shows similar protein distribution across tissues to independent antibody HPA021165 (B).
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human skeletal muscle shows high expression.
Immunohistochemical staining of human lymph node using Anti-KLHL41 antibody HPA021760.
Immunohistochemical staining of human colon using Anti-KLHL41 antibody HPA021760.
HPA021760-100ul
HPA021760-100ul
HPA021760-100ul