Anti-KLHL41 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-KLHL41 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA021760
• Supplier Catalog Number: HPA021760
• Alternative Catalog Number: ATA-HPA021760-100,ATA-HPA021760-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: KBTBD10, Krp1, SARCOSIN

Product Description

kelch-like family member 41

Additional Information

Anti-KLHL41

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 10324
• UniProt: O60662
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: SNDSLNVEKEEAVFEAVMKWVRTDKENRVKNLSEVFDCIRFRLMTEKYFKDHVEKDDIIKSNPDLQK
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: KLHL41
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:500 - 1:1000

Images

Immunohistochemistry analysis in human skeletal muscle and liver tissues using Anti-KLHL41 antibody. Corresponding KLHL41 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human colon, liver, lymph node and skeletal muscle using Anti-KLHL41 antibody HPA021760 (A) shows similar protein distribution across tissues to independent antibody HPA021165 (B).

Immunohistochemical staining of human liver shows low expression as expected.

Immunohistochemical staining of human skeletal muscle shows high expression.

Immunohistochemical staining of human lymph node using Anti-KLHL41 antibody HPA021760.

Immunohistochemical staining of human colon using Anti-KLHL41 antibody HPA021760.

HPA021760

HPA021760

HPA021760