Anti-DYSF Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA021945
Artikelname: Anti-DYSF Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA021945
Hersteller Artikelnummer: HPA021945
Alternativnummer: ATA-HPA021945-100,ATA-HPA021945-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FER1L1, LGMD2B
dysferlin
Anti-DYSF
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 8291
UniProt: O75923
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: CHYYYLPWGNVKPVVVLSSYWEDISHRIETQNQLLGIADRLEAGLEQVHLALKAQCSTEDVDSLVAQLTDELIAGCSQPLGDIHETPSATHLDQYLYQLRTHHLSQITEAALALKLGHSELPAALEQAEDWLLRLRALA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DYSF
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human skeletal muscle and skin tissues using Anti-DYSF antibody. Corresponding DYSF RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney, skeletal muscle, skin and testis using Anti-DYSF antibody HPA021945 (A) shows similar protein distribution across tissues to independent antibody HPA017071 (B).
Immunohistochemical staining of human skin shows low expression as expected.
Immunohistochemical staining of human skeletal muscle shows high expression.
Immunohistochemical staining of human testis using Anti-DYSF antibody HPA021945.
Immunohistochemical staining of human kidney using Anti-DYSF antibody HPA021945.
HPA021945
HPA021945
HPA021945