Anti-DYSF Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-DYSF Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA021945
• Supplier Catalog Number: HPA021945
• Alternative Catalog Number: ATA-HPA021945-100,ATA-HPA021945-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FER1L1, LGMD2B

Product Description

dysferlin

Additional Information

Anti-DYSF

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 8291
• UniProt: O75923
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: CHYYYLPWGNVKPVVVLSSYWEDISHRIETQNQLLGIADRLEAGLEQVHLALKAQCSTEDVDSLVAQLTDELIAGCSQPLGDIHETPSATHLDQYLYQLRTHHLSQITEAALALKLGHSELPAALEQAEDWLLRLRALA
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: DYSF
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunohistochemistry analysis in human skeletal muscle and skin tissues using Anti-DYSF antibody. Corresponding DYSF RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human kidney, skeletal muscle, skin and testis using Anti-DYSF antibody HPA021945 (A) shows similar protein distribution across tissues to independent antibody HPA017071 (B).

Immunohistochemical staining of human skin shows low expression as expected.

Immunohistochemical staining of human skeletal muscle shows high expression.

Immunohistochemical staining of human testis using Anti-DYSF antibody HPA021945.

Immunohistochemical staining of human kidney using Anti-DYSF antibody HPA021945.

HPA021945

HPA021945

HPA021945