Anti-DYSF

Catalog Number: ATA-HPA021945
Article Name: Anti-DYSF
Biozol Catalog Number: ATA-HPA021945
Supplier Catalog Number: HPA021945
Alternative Catalog Number: ATA-HPA021945-100,ATA-HPA021945-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FER1L1, LGMD2B
dysferlin
Anti-DYSF
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 8291
UniProt: O75923
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: CHYYYLPWGNVKPVVVLSSYWEDISHRIETQNQLLGIADRLEAGLEQVHLALKAQCSTEDVDSLVAQLTDELIAGCSQPLGDIHETPSATHLDQYLYQLRTHHLSQITEAALALKLGHSELPAALEQAEDWLLRLRALA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: DYSF
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human skeletal muscle and skin tissues using Anti-DYSF antibody. Corresponding DYSF RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney, skeletal muscle, skin and testis using Anti-DYSF antibody HPA021945 (A) shows similar protein distribution across tissues to independent antibody HPA017071 (B).
Immunohistochemical staining of human skin shows low expression as expected.
Immunohistochemical staining of human skeletal muscle shows high expression.
Immunohistochemical staining of human testis using Anti-DYSF antibody HPA021945.
Immunohistochemical staining of human kidney using Anti-DYSF antibody HPA021945.
HPA021945-100ul
HPA021945-100ul
HPA021945-100ul