Anti-CHST4
Artikelnummer:
ATA-HPA021955
- Bilder (8)
| Artikelname: | Anti-CHST4 |
| Artikelnummer: | ATA-HPA021955 |
| Hersteller Artikelnummer: | HPA021955 |
| Alternativnummer: | ATA-HPA021955-100,ATA-HPA021955-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HEC-GLCNAC-6-ST, LSST |
| carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4 |
| Anti-CHST4 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10164 |
| UniProt: | Q8NCG5 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TSRMYEFVGLEFLPHLQTWVHNITRGKGMGDHAFHTNARDALNVSQAWRWSLPYEKVSRLQKACGDAMNLLGYRHVRSEQEQRNLLLDLLSTWTVPEQIH |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CHST4 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human gallbladder and kidney tissues using HPA021955 antibody. Corresponding CHST4 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human gallbladder shows positivity in glandular cells. |
|
|
Immunohistochemical staining of human fallopian tube shows positivity in glandular cells. |
|
|
Immunohistochemical staining of human liver shows positivity in bile duct cells. |
|
|
Immunohistochemical staining of human kidney shows no positivity as expected. |
|
|
HPA021955-100ul |
|
|
HPA021955-100ul |
|
|
HPA021955-100ul |
Produktgarantie und fachkundiger Support
